.
The Open Protein Structure Annotation Network
PDB Keyword
.

1zl0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of hypothetical protein PA5198 at 1.1 A resolution. To be Published
    Site MCSG
    PDB Id 1zl0 Target Id APC5619
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS4724,NP_253885, 208964 Molecular Weight 33286.09 Da.
    Residues 307 Isoelectric Point 6.30
    Sequence mtsrpssdqtwqpidgrvaliapasaiatdvleatlrqlevhgvdyhlgrhvearyrylagtveqrled lhnafdmpditavwclrggygcgqllpgldwgrlqaasprpligfsdisvllsafhrhglpaihgpvat glglsplsapreqqerlaslasvsrllagidhelpvqhlgghkqrvegaliggnltalacmagtlgglh apagsilvledvgepyyrlerslwqllesidarqlgaiclgsftdcprkevahslerifgeyaaaievp lyhhlpsghgaqnrawpygktavlegnrlrw
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.10 Rfree 0.12082
    Matthews' coefficent 2.20 Rfactor 0.09866
    Waters 1039 Solvent Content 43.40

    Ligand Information
    Ligands TLA (L(+)-TARTARIC) x 1;EDO (1,2-ETHANEDIOL) x 12;GOL (GLYCEROL) x 1;PEG (DI(HYDROXYETHYL)ETHER) x 1
    Metals K (POTASSIUM) x 2;NA (SODIUM) x 1

    Jmol

     
    Google Scholar output for 1zl0
    1. Folds and activities of peptidoglycan amidases
    M Firczuk, M Bochtler - FEMS microbiology reviews, 2007 - Wiley Online Library
     
    2. An indel in transmembrane helix 2 helps to trace the molecular evolution of class A G-protein-coupled receptors
    J Devill, J Rey, M Chabbert - Journal of molecular evolution, 2009 - Springer
     
    3. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    4. Modeling of the full-length Escherichia coli SeqA protein, in complex with DNA
    D Daghfous, A Chatti, R Hammami, A Landoulsi - Pathologie Biologie, 2009 - Elsevier
     
    5. A hierarchical order within protein structures underlies large separations between strands in __sheets
    B Wathen, Z Jia - Proteins: Structure, Function, and , 2012 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch