.
The Open Protein Structure Annotation Network
PDB Keyword
.

1zki

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of conserved protein PA5202 from Pseudomonas aeruginosa. To be Published
    Site MCSG
    PDB Id 1zki Target Id APC5034
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS4645,AAG08587, 208964 Molecular Weight 13813.21 Da.
    Residues 129 Isoelectric Point 6.90
    Sequence msempareqmisayselvgldpvslgdgvaevrlpmaahlrnrggvmhggalfslmdvtmglacssshg fdrqsvtleckinyiravadgevrcvarvlhagrrslvveaevrqgdklvakgqgtfaql
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.19378
    Matthews' coefficent 2.00 Rfactor 0.16035
    Waters 252 Solvent Content 37.70

    Ligand Information
    Ligands ACY (ACETIC) x 1
    Metals

    Jmol

     
    Google Scholar output for 1zki
    1. An iterative knowledge_based scoring function for proteinprotein recognition
    SY Huang, X Zou - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     
    2. Analysis of proteins with the'hot dog'fold: Prediction of function and identification of catalytic residues of hypothetical proteins
    LS Pidugu, K Maity, K Ramaswamy - BMC structural , 2009 - biomedcentral.com
     
    3. Structure and activity of the Pseudomonas aeruginosa hotdog-fold thioesterases PA5202 and PA2801
    FG Claudio, T Anatoli, B Greg, F Robert, E Elena - Biochemical , 2012 - biochemj.org
     
    4. Structure and activity of the Pseudomonas aeruginosa hotdog-fold thioesterases PA5202 and PA2801
    CF Gonzalez, A Tchigvintsev, G Brown, R Flick - Biochemical , 2012 - 82.45.151.66
     
    5. Structure and activity of the {Less than} i {Greater than} Pseudomonas aeruginosa {Less than}/i {Greater than} hotdog-fold thioesterases PA5202 and PA2801
    C Gonzalez, A Tchigvintsev, G Brown, R Flick - 2012 - biochemj.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch