.
The Open Protein Structure Annotation Network
PDB Keyword
.

1z77

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a transcriptional regulator TM1030 from Thermotoga maritima solved by an unusual MAD experiment. J.Struct.Biol. 159 424-432 2007
    Site MCSG
    PDB Id 1z77 Target Id APC4542
    Related PDB Ids 3ih3 3ih2 3ih4 
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS4611,AAD36107, 2336 Molecular Weight 23799.48 Da.
    Residues 200 Isoelectric Point 6.25
    Sequence mlskrdailkaavevfgkkgydrattdeiaekagvakglifhyfknkeelyyqaymsvteklqkefenf lmknrnrdifdfmerwiekkleysashpeeadflitlvsvdeglrkrilldleksqrvffdfvreklkd ldlaedvteeialkflmwffsgfeevylrtyqgkpellkrdmntlveevkvmlrilkkgmtk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.26671
    Matthews' coefficent 2.12 Rfactor 0.22944
    Waters 36 Solvent Content 41.89

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 2
    Metals

    Jmol

     
    Google Scholar output for 1z77
    1. Crystal structure of the Vibrio cholerae quorum-sensing regulatory protein HapR
    RS De Silva, G Kovacikova, W Lin, RK Taylor - Journal of , 2007 - Am Soc Microbiol
     
    2. Crystal structure of a transcriptional regulator TM1030 from Thermotoga maritima solved by an unusual MAD experiment
    KD Koclega, M Chruszcz, MD Zimmerman - Journal of structural , 2007 - Elsevier
     
    3. Hot Macromolecular Crystals
    KD Koclega, M Chruszcz, MD Zimmerman - Crystal growth & , 2009 - ACS Publications
     
    4. Crystal structure of TM1030 from Thermotoga maritima at 2.3 resolution reveals molecular details of its transcription repressor function
    L Premkumar, CL Rife, S Sri Krishna - Proteins: Structure, , 2007 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch