.
The Open Protein Structure Annotation Network
PDB Keyword
.

1z6n

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 1.5A crystal structure of a hypothetical protein PA1234 from Pseudomonas aeruginosa. To be Published
    Site MCSG
    PDB Id 1z6n Target Id APC5575
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS4702,NP_249925, 208964 Molecular Weight 18459.08 Da.
    Residues 167 Isoelectric Point 4.91
    Sequence masyaelfdigedfaafvghglateqgavarfrqklesnglpsalterlqrierryrllvagemwcpdc qinlaaldfaqrlqpnielaiiskgraeddlrqrlaleriaiplvlvldeefnllgrfverpqavldgg pqalaaykagdylehaigdvlaiiegaar
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.22047
    Matthews' coefficent 2.41 Rfactor 0.18902
    Waters 257 Solvent Content 47.00

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 1z6n
    1. Structural basis for target protein recognition by the protein disulfide reductase thioredoxin
    K Maeda, P Hgglund, C Finnie, B Svensson - Structure, 2006 - Elsevier
     
    2. Computational design of epitope-scaffolds allows induction of antibodies specific for a poorly immunogenic HIV vaccine epitope
    BE Correia, YEA Ban, MA Holmes, H Xu, K Ellingson - Structure, 2010 - Elsevier
     
    3. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    4. A novel structural motif and structural trees for proteins containing it
    AM Kargatov, AV Efimov - Biochemistry (Moscow), 2010 - Springer
     
    5. Disulfide conformation and design at helix N_termini
    S Indu, ST Kumar, S Thakurela, M Gupta - Proteins: Structure, , 2010 - Wiley Online Library
     
    6. Dimensionality reduction in computational demarcation of protein tertiary structures
    RR Joshi, PR Panigrahi, RN Patil - Journal of Molecular Modeling, 2011 - Springer
     
    7. Modelling Protein Structure Using Discrete Backbone Torsion Angles
    P Smith - 2010 - unsworks.unsw.edu.au
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch