.
The Open Protein Structure Annotation Network
PDB Keyword
.

1z1s

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Conserved Hypothetical Protein PA3332 from Pseudomonas aeruginosa. To be Published
    Site MCSG
    PDB Id 1z1s Target Id APC5612
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS4722,NP_252022, 208964 Molecular Weight 15919.24 Da.
    Residues 141 Isoelectric Point 5.44
    Sequence mnakeilvhslrllengdargwcdlfhpegvlefpyappgwktrfegretiwahmrlfpehltvrftdv qfyetadpdlaigefhgdgvatvsggklaqdyisvlrtrdgqillyrdfwnplrhlealggveaaakiv qga
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.49 Rfree 0.20492
    Matthews' coefficent 2.25 Rfactor 0.16778
    Waters 213 Solvent Content 45.30

    Ligand Information
    Ligands PGE (TRIETHYLENE) x 1
    Metals MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 1z1s
    1. Blind prediction of quaternary structures of homo-oligomeric proteins from amino acid sequences based on templates
    M Morita, M Kakuta, K Shimizu, S Nakamura - 2012 - hoajonline.com
     
    2. Dimensionality reduction in computational demarcation of protein tertiary structures
    RR Joshi, PR Panigrahi, RN Patil - Journal of Molecular Modeling, 2011 - Springer
     
    3. Modelling Protein Structure Using Discrete Backbone Torsion Angles
    P Smith - 2010 - unsworks.unsw.edu.au
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch