.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yvo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of a hypothetical acetyltransferase from P.aeruginosa PA01. To be Published
    Site MCSG
    PDB Id 1yvo Target Id APC5603
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS4715,AAG08251, 208964 Molecular Weight 18742.15 Da.
    Residues 172 Isoelectric Point 5.89
    Sequence msasirdagvadlpgilaiyndavgnttaiwnetpvdlanrqawfdtrarqgypilvasdaagevlgya sygdwrpfegfrgtvehsvyvrddqrgkglgvqllqalieraraqglhvmvaaiesgnaasiglhrrlg feisgqmpqvgqkfgrwldltfmqlnldptrsap
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.90 Rfree 0.20807
    Matthews' coefficent 2.28 Rfactor 0.18566
    Waters 266 Solvent Content 45.74

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1yvo
    1. Isoform_specific variation in the intrinsic disorder of troponin I
    R Hoffman, BD Sykes - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     
    2. Switch action of troponin on muscle thin filament as revealed by spin labeling and pulsed EPR
    T Aihara, M Nakamura, S Ueki, H Hara, M Miki - Journal of Biological , 2010 - ASBMB
     
    3. l-Methionine sulfoximine, but not phosphinothricin, is a substrate for an acetyltransferase (gene PA4866) from Pseudomonas aeruginosa: structural and functional
    AM Davies, R Tata, RL Beavil, BJ Sutton - Biochemistry, 2007 - ACS Publications
     
    4. Structure and substrate specificity of acetyltransferase ACIAD1637 from Acinetobacter baylyi ADP1
    AM Davies, R Tata, A Snape, BJ Sutton, PR Brown - Biochimie, 2009 - Elsevier
     
    5. Structure of a putative acetyltransferase (PA1377) from Pseudomonas aeruginosa
    AM Davies, R Tata, FX Chauviac, BJ Sutton - Section F: Structural , 2008 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch