.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ytl

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Acetyl-CoA decarbonylase/synthase complex epsilon subunit 2 from Archaeoglobus fulgidus. To be Published
    Site MCSG
    PDB Id 1ytl Target Id APC5601
    Molecular Characteristics
    Source Archaeoglobus fulgidus dsm 4304
    Alias Ids TPS4713,AAB91265.1, 224325 Molecular Weight 19700.92 Da.
    Residues 175 Isoelectric Point 5.81
    Sequence makaleqpfdvanipgpkmatllekgkpvanmikkakrpllivgpdmtdemfervkkfvekditvvatg saitrfidaglgekvnyavlheltqflldpdwkgfdgqgnydlvlmlgsiyyhgsqmlaaiknfaphir alaidryyhpnadmsfgnlwkkeedylklldeilael
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.80 Rfree 0.21408
    Matthews' coefficent 2.00 Rfactor 0.17084
    Waters 500 Solvent Content 37.80

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch