.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ysp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural study of effector binding specificity in IclR transcriptional regulators. To be Published
    Site MCSG
    PDB Id 1ysp Target Id APC5610
    Molecular Characteristics
    Source Escherichia coli k12
    Alias Ids TPS4720,AAC74897, 83333 Molecular Weight 30027.75 Da.
    Residues 263 Isoelectric Point 5.44
    Sequence manadldkqpdsvssvlkvfgilqalgeereigitelsqrvmmskstvyrflqtmktlgyvaqegesek ysltlklfelgaralqnvdlirsadiqmrelsrltketihlgaldedsivyihkidsmynlrmysrigr rnplystaigkvllawrdrdevkqilegveykrstertitsteallpvldqvreqgygedneeqeeglr ciavpvfdrfgvviaglsisfptlrfseerlqeyvamlhtaarkisaqmgyhdypf
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.80 Rfree 0.25855
    Matthews' coefficent 2.40 Rfactor 0.21181
    Waters 125 Solvent Content 47.40

    Ligand Information
    Ligands SO4 (SULFATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 1ysp
    1. Members of the IclR family of bacterial transcriptional regulators function as activators and/or repressors
    AJ Molina_Henares, T Krell - FEMS microbiology , 2006 - Wiley Online Library
     
    2. Glyoxylate and pyruvate are antagonistic effectors of the Escherichia coli IclR transcriptional regulator
    GL Lorca, A Ezersky, VV Lunin, JR Walker - Journal of Biological , 2007 - ASBMB
     
    3. The IclR family of transcriptional activators and repressors can be defined by a single profile
    T Krell, AJ Molina_Henares, JL Ramos - Protein science, 2006 - Wiley Online Library
     
    4. Structural and biochemical study of effector molecule recognition by the E. coli glyoxylate and allantoin utilization regulatory protein AllR
    JR Walker, S Altamentova, A Ezersky, G Lorca - Journal of molecular , 2006 - Elsevier
     
    5. Different Modes of Binding of Mono-and Biaromatic Effectors to the Transcriptional Regulator TTGV
    ME Guazzaroni, MT Gallegos, JL Ramos - Journal of Biological , 2007 - ASBMB
     
    6. Structural and functional characterization of IclR transcription regulators
    A Ezersky - 2009 - 142.150.190.46
     
    7. Bases moleculares de la tolerancia a disolventes orgnicos: estudio de la regulacin de la bomba de expulsin de disolventes TtgGHI en Pseudomonas
    ME Guazzaroni - 2007 - 0-hera.ugr.es.adrastea.ugr.es
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch