.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yre

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of hypothetical protein PA3270 from Pseudomonas aeruginosa in complex with CoA. To be Published
    Site MCSG
    PDB Id 1yre Target Id APC5563
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS4694,NP_251960, 208964 Molecular Weight 21900.04 Da.
    Residues 195 Isoelectric Point 9.50
    Sequence msrrapmfkplpitlqrgalrleplveadipelvslaeanrealqymdgptrpdwyrqslaeqregral plavrlgvqlvgttrfaeflpalpaceigwtwldqaqhgsglnrmikylmlkhafdnlrmvrvqlstaa snlraqgaidklgaqregvlrnhrrlaggrlddtfvysitdhewpqvkaaleasftg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.15 Rfree 0.26451
    Matthews' coefficent 2.10 Rfactor 0.2011
    Waters 428 Solvent Content 42.00

    Ligand Information
    Ligands COA (COENZYME) x 4
    Metals

    Jmol

     
    Google Scholar output for 1yre
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch