.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yoz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of predicted coding region AF0941 from Archaeoglobus fulgidus. To be Published
    Site MCSG
    PDB Id 1yoz Target Id APC5573
    Molecular Characteristics
    Source Archaeoglobus fulgidus dsm 4304
    Alias Ids TPS4700,AAB90315, 224325 Molecular Weight 13573.93 Da.
    Residues 114 Isoelectric Point 5.06
    Sequence mlyinsfldrmgeiirgeksveeadklldqknifemfrsdceeilnlyksgkaekeevqrnfyllktyv vsqlsihferlkefaeskgfkiekkldpevineialyidrvekev
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.30031
    Matthews' coefficent 2.10 Rfactor 0.23091
    Waters 199 Solvent Content 40.00

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1yoz
    1. An iterative knowledge_based scoring function for proteinprotein recognition
    SY Huang, X Zou - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     
    2. Short-Lived _-Helical Intermediates in the Folding of _-Sheet Proteins
    E Chen, ML Everett, ZE Holzknecht, RA Holzknecht - Biochemistry, 2010 - ACS Publications
     
    3. Structural characterization of Rv0008c--An integral membrane protein from Mycobacterium tuberculosis by solution Nuclear Magnetic Resonance
    HTB Nguyen - 2008 - books.google.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch