.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ynb

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of genomics AF1432 by Sulfur SAD methods. To be Published
    Site MCSG
    PDB Id 1ynb Target Id APC5600
    Related PDB Ids 1yoy 
    Molecular Characteristics
    Source Archaeoglobus fulgidus
    Alias Ids TPS4711,G69428, 2234 Molecular Weight 19790.69 Da.
    Residues 173 Isoelectric Point 5.78
    Sequence mciikpmddvvkfihevgslkltprsgwlklgirlpesvaehsfraaiiafilalksgesvekackaat aalfhdlheartmdlhkiarryvscdeegareeqlswmeskpdfsdvevyvsdadklelafqgveysqq vsyairfaenvelktdaakeiyrvlmerknpvwwr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 1.76 Rfree 0.243
    Matthews' coefficent 2.46 Rfactor 0.206
    Waters 280 Solvent Content 49.50

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1ynb
    1. Crystal structure of a substrate complex of myo-inositol oxygenase, a di-iron oxygenase with a key role in inositol metabolism
    PM Brown, TT Caradoc-Davies - Proceedings of the , 2006 - National Acad Sciences
     
    2. Structural insight into the mechanism of substrate specificity and catalytic activity of an HD-domain phosphohydrolase: the 5'-deoxyribonucleotidase YfbR from
    MD Zimmerman, M Proudfoot, A Yakunin - Journal of molecular , 2008 - Elsevier
     
    3. Structure of dNTP-inducible dNTP triphosphohydrolase: insight into broad specificity for dNTPs and triphosphohydrolase-type hydrolysis
    N Kondo, N Nakagawa, A Ebihara, L Chen - Section D: Biological , 2007 - scripts.iucr.org
     
    4. De novo sulfur SAD phasing of the lysosomal 66.3 kDa protein from mouse
    K Lakomek, A Dickmanns, U Mueller - Section D: Biological , 2009 - scripts.iucr.org
     
    5. Structure of O67745_AQUAE, a hypothetical protein from Aquifex aeolicus
    V Oganesyan, PD Adams, J Jancarik, R Kim - Section F: Structural , 2007 - iucr.org
     
    6. VV prasanth & S. Chitti: Predicting the function of a hypothetical protein from Pyrococcus horikoshii OT3 as HD domain containing metal-dependent
    PA Babu, K Harshita - The Internet Journal of Genomics and Proteomics, 2010 - ispub.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch