.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ylm

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Hypothetical cytosolic protein YutE from Bacillus subtilis. To be Published
    Site MCSG
    PDB Id 1ylm Target Id APC1684
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS4554,O32126, 1423 Molecular Weight 16649.18 Da.
    Residues 144 Isoelectric Point 4.77
    Sequence myfvdrskiektlgffehqlalfdsqtdwqseigelalqrighlliecildtgndmidgfimrdpgsyd dimdilvdekvvtekegdelkkliayrktlvqqylladsgelyrlikahqtalqdfpkrirsyletelg pvsafk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.83 Rfree 0.2385
    Matthews' coefficent 2.76 Rfactor 0.19972
    Waters 335 Solvent Content 55.11

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1ylm
    1. An iterative knowledge_based scoring function for proteinprotein recognition
    SY Huang, X Zou - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch