.
The Open Protein Structure Annotation Network
PDB Keyword
.

1yle

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of arginine/ornithine succinyltransferase subunit AI from Pseudomonas aeruginosa. To be Published
    Site MCSG
    PDB Id 1yle Target Id APC5537
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS4678,AAG04285, 208964 Molecular Weight 36928.65 Da.
    Residues 338 Isoelectric Point 4.90
    Sequence mlvmrpaqaadlpqvqrlaadspvgvtslpddaerlrdkilaseasfaaevsyngeesyffvledsasg elvgcsaivasagfsepfysfrnetfvhasrslsihnkihvlslchdltgnslltsfyvqrdlvqsvya elnsrgrllfmashperfadavvveivgysdeqgespfwnavgrnffdlnyieaeklsglksrtflael mphypiyvpllpdaaqesmgqvhpraqitfdilmregfetdnyidifdggptlhartsgirsiaqsrvv pvkigeapksgrpylvtngqlqdfravvldldwapgkpvalsveaaealgvgegasvrlvav
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.22195
    Matthews' coefficent 2.30 Rfactor 0.18996
    Waters 542 Solvent Content 46.60

    Ligand Information
    Ligands FMT (FORMIC) x 1
    Metals CA (CALCIUM) x 1

    Jmol

     
    Google Scholar output for 1yle
    1. Cradle-loop barrels and the concept of metafolds in protein classification by natural descent
    V Alva, KK Koretke, M Coles, AN Lupas - Current opinion in structural , 2008 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch