.
The Open Protein Structure Annotation Network
PDB Keyword
.

1y8a

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of gene product AF1437 from Archaeoglobus fulgidus. To be published
    Site MCSG
    PDB Id 1y8a Target Id APC5532
    Molecular Characteristics
    Source Archaeoglobus fulgidus dsm 4304
    Alias Ids TPS4675,AAB89817, 224325 Molecular Weight 34456.55 Da.
    Residues 308 Isoelectric Point 4.90
    Sequence mfftdwegpwiltdfalelcmavfnnarffsnlseyddylayevrregyeagytlklltpflaaagvkn rdveriaelsakfvpdaekamatlqerwtpvvistsytqylrrtasmigvrgelhgtevdfdsiavpeg lreellsiidviaslsgeelfrkldelfsrsevrkivesvkavgagekakimrgyceskgidfpvvvgd sisdykmfeaarglggvaiafngneyalkhadvaiisptamseakvielfmerkerafevlsavsipet eiyimensdfgevlekskrmrvrlrglagelg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.40 Rfree 0.2227
    Matthews' coefficent 2.00 Rfactor 0.18278
    Waters 409 Solvent Content 38.60

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 1y8a
    1. Evolutionary genomics of the HAD superfamily: understanding the structural adaptations and catalytic diversity in a superfamily of phosphoesterases and allied
    AM Burroughs, KN Allen, D Dunaway-Mariano - Journal of molecular , 2006 - Elsevier
     
    2. Structural statistical properties of knotted proteins
    W Xiang-Hong, S Yu, Z Lin-Xi - Chinese Physics B, 2009 - iopscience.iop.org
     
    3. Fast and accurate computation schemes for evaluating vibrational entropy of proteins
    B Xu, H Shen, X Zhu, G Li - Journal of computational chemistry, 2011 - Wiley Online Library
     
    4. Crystal structure of MtnX phosphatase from Bacillus subtilis at 2.0 resolution provides a structural basis for bipartite phosphomonoester hydrolysis of 2_hydroxy_3_
    Q Xu, KS Saikatendu, S Krishna - Proteins: Structure, , 2007 - Wiley Online Library
     
    5. Modelling Protein Structure Using Discrete Backbone Torsion Angles
    P Smith - 2010 - unsworks.unsw.edu.au
     
    6. Analysis of Protein Structure using Geometric and Machine Learning Techniques
    A Tendulkar - 2007 - it.iitb.ac.in
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch