.
The Open Protein Structure Annotation Network
PDB Keyword
.

1y88

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of hypothetical protein AF1548 from Archaeoglobus fulgidus. To be Published
    Site MCSG
    PDB Id 1y88 Target Id APC5567
    Molecular Characteristics
    Source Archaeoglobus fulgidus dsm 4304
    Alias Ids TPS4696,NP_070377, 224325 Molecular Weight 19763.83 Da.
    Residues 174 Isoelectric Point 5.56
    Sequence marlleehgfetktnvivqgncveqeidvvaerdgerymieckfhnipvytglkeamytyarfldvekh gftqpwiftntkfseeakkyagcvgikltgwsypekegievlleskglypitilridkevldelvragl vfcrdvvsageeklreiglsakkareviaeakkvig
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.85 Rfree 0.2329
    Matthews' coefficent 3.50 Rfactor 0.20163
    Waters 151 Solvent Content 65.00

    Ligand Information
    Ligands SO4 (SULFATE) x 9
    Metals CL (CHLORIDE) x 1

    Jmol

     
    Google Scholar output for 1y88
    1. The Sorcerer II Global Ocean Sampling expedition: expanding the universe of protein families
    S Yooseph, G Sutton, DB Rusch, AL Halpern - PLoS biology, 2007 - dx.plos.org
     
    2. Prokaryotic homologs of Argonaute proteins are predicted to function as key components of a novel system of defense against mobile genetic elements
    KS Makarova, YI Wolf, J Van Der Oost, EV Koonin - Biol Direct, 2009 - biomedcentral.com
     
    3. Topology of Type II REases revisited; structural classes and the common conserved core
    MY Niv, DR Ripoll, JA Vila, A Liwo - Nucleic acids , 2007 - Oxford Univ Press
     
    4. Mutational analysis and a structural model of methyl-directed restriction enzyme Mrr
    J Orlowski, MT Mebrhatu, CW Michiels - Biochemical and , 2008 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch