| Title | Crystal Structure of the putative arsenical resistance operon repressor from Archaeoglobus fulgidus. To be Published | | Site | MCSG | | PDB Id | | Target Id | APC5036 | | Molecular Characteristics | | Source | Archaeoglobus fulgidus | | Alias Ids | TPS4647,AAB91060, 2234 | Molecular Weight | 10825.97 Da. | | Residues | 92 | Isoelectric Point | 8.71 | | Sequence | msleewikadslekadeyhkrynyavtnpvrrkilrmldkgrseeeimqtlslskkqldyhlkvleagf ciervgerwvvtdagkivdkirg | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 1.60 | Rfree | 0.20144 | | Matthews' coefficent | 1.96 | Rfactor | 0.17172 | | Waters | 263 | Solvent Content | 36.90 |
| Ligand Information | | Ligands | ACT (ACETATE) x 1 | | Metals | | | |
