.
The Open Protein Structure Annotation Network
PDB Keyword
.

1y0b

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Xanthine Phosphoribosyltransferase from Bacillus subtilis. To be Published
    Site MCSG
    PDB Id 1y0b Target Id APC1452
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS4538,P42085, 1423 Molecular Weight 21037.04 Da.
    Residues 194 Isoelectric Point 5.86
    Sequence mealkrkieeegvvlsdqvlkvdsflnhqidpllmqrigdefasrfakdgitkivtiessgiapavmtg lklgvpvvfarkhksltltdnlltasvysftkqtesqiavsgthlsdqdhvliiddflangqaahglvs ivkqagasiagigivieksfqpgrdelvklgyrveslariqsleegkvsfvqevhs
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.80 Rfree 0.22818
    Matthews' coefficent 2.20 Rfactor 0.17831
    Waters 840 Solvent Content 42.60

    Ligand Information
    Ligands G4P (GUANOSINE-5',3'-TETRAPHOSPHATE) x 4
    Metals NA (SODIUM) x 8

    Jmol

     
    Google Scholar output for 1y0b
    1. The extraordinary specificity of xanthine phosphoribosyltransferase from Bacillus subtilis elucidated by reaction kinetics, ligand binding, and crystallography
    S Arent, A Kadziola, S Larsen, J Neuhard - Biochemistry, 2006 - ACS Publications
     
    2. Protein structure prediction based on the sliced lattice model
    CC Wang, CB Yang, HY Ann - 2008 Conference on , 2005 - etd.lib.nsysu.edu.tw
     
    3. Protein structure-based method for identifying horizontal gene transfer
    VRB Santosh, MA Griep, PZ Revesz - Proceedings of The Fourth , 2011 - dl.acm.org
     
    4. Identifying Horizontal Gene Transfer Using Anomalies In Protein Structures And Sequences
    VRB Santosh - 2011 - digitalcommons.unl.edu
     
    5. Microbial drug target identification using different computational approaches: Specific application to Pseudomonas aeruginosa
    D Perumal, CS Lim - Innovations in Information , 2008 - ieeexplore.ieee.org
     
    6. Prediction of Protein Backbone Based on the Sliced Lattice Model
    CC Wang, CB Yang, HY Ann, HY Chang - 2008 - csie.npu.edu.tw
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch