| Title | The crystal structure of PhoU (phosphate uptake regulator). To be Published | | Site | MCSG | | PDB Id | | Target Id | APC36012 | | Molecular Characteristics | | Source | Bacillus stearothermophilus | | Alias Ids | TPS5531,RBSTP1653, 1422 | Molecular Weight | 24325.54 Da. | | Residues | 217 | Isoelectric Point | 4.80 | | Sequence | mretfaddlrslhnkliemgrltevalqqaieafqtqnknlamavidgdgsidkleeevndfalwliak qqpvatdlrrivaaikiasdieriadfavniakaciriggqpfvmdigplvlmyrlatdmvstaiaayd redaslaaqiadmdhrvdeqygemmksllevektdketlaqmnvlalvaryiertadhatniaehlvyl vkgkhydfnd | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 2.50 | Rfree | 0.334 | | Matthews' coefficent | 2.29 | Rfactor | 0.243 | | Waters | 5 | Solvent Content | 44.22 |
| Ligand Information | | Ligands | | | Metals | | | |
