| Title | Crystal Structure of YedP, phosphatase-like domain protein from Escherichia coli K12. To be Published | | Site | MCSG | | PDB Id | | Target Id | APC5010 | | Molecular Characteristics | | Source | Escherichia coli k12 | | Alias Ids | TPS4636,AAC75021, 83333 | Molecular Weight | 30437.71 Da. | | Residues | 271 | Isoelectric Point | 4.93 | | Sequence | mfsiqqpllvfsdldgtlldshsydwqpaapwltrlreanvpvilcssktsaemlylqktlglqglpli aengaviqlaeqwqeidgfpriisgishgeislvlntlrekehfkfttfddvddatiaewtglsrsqaa ltqlheasvtliwrdsdermaqftarlnelglqfmqgarfwhvldasagkdqaanwiiatyqqlsgkrp ttlglgdgpndapllevmdyavivkglnregvhlhdedparvwrtqregpegwregldhffsar | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 2.26 | Rfree | 0.24334 | | Matthews' coefficent | 2.70 | Rfactor | 0.18388 | | Waters | 388 | Solvent Content | 54.80 |
| Ligand Information | | Ligands | SO4 (SULFATE) x 3;1PE (PENTAETHYLENE) x 1;PG4 (TETRAETHYLENE) x 1;PGE (TRIETHYLENE) x 1 | | Metals | | | |
