.
The Open Protein Structure Annotation Network
PDB Keyword
.

1xpp

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of TA1416, DNA-directed RNA polymerase subunit L, from Thermoplasma acidophilum. To be Published
    Site MCSG
    PDB Id 1xpp Target Id APC5039
    Molecular Characteristics
    Source Thermoplasma acidophilum
    Alias Ids TPS4650,NP_394870, 2303 Molecular Weight 13132.36 Da.
    Residues 111 Isoelectric Point 8.80
    Sequence mqrertaesslrviskeknsitveminydntllrtlveeilkddqvdearyyikhpvidnpqiyvrvks gkpqsaikravrklsklyedlgtqfqkefqryesdhmikave
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.60 Rfree 0.26351
    Matthews' coefficent 2.51 Rfactor 0.21904
    Waters 381 Solvent Content 51.00

    Ligand Information
    Ligands SCN (THIOCYANATE) x 3;ACY (ACETIC) x 1;FMT (FORMIC) x 1
    Metals

    Jmol

     
    Google Scholar output for 1xpp
    1. MODELING PROTEIN INTERACTIONS THROUGH STRUCTURE ALIGNMENT
    R Sinha - 2011 - kuscholarworks.ku.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch