| Title | Crystal structure of Escherichia coli yfbU gene product. To be Published | | Site | MCSG | | PDB Id | | Target Id | APC042 | | Molecular Characteristics | | Source | Escherichia coli | | Alias Ids | TPS4421,AAC75354, 562 | Molecular Weight | 19535.28 Da. | | Residues | 164 | Isoelectric Point | 6.07 | | Sequence | memtnaqrlilsnqykmmtmldpanaeryrrlqtiiergyglqmreldrefgelkeetcrtiidimemy halhvswsnlqdqqsiderrvtflgfdaatearylgyvrfmvnvegrythfdagthgfnaqtpmwekyq rmlnvwhacprqyhlsaneinqiina | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 16 | | Resolution (Å) | 2.00 | Rfree | 0.22652 | | Matthews' coefficent | 2.80 | Rfactor | 0.18951 | | Waters | 1618 | Solvent Content | 55.30 |
| Ligand Information | | Ligands | GOL (GLYCEROL) x 44 | | Metals | CL (CHLORIDE) x 36 | | |
