.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ufh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of the bacillus subtilis YYCN protein: a putative N-acetyltransferase. Proteins 53 950-952 2003
    Site MCSG
    PDB Id 1ufh Target Id APC1846
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS4569,O32293, 1423 Molecular Weight 18163.92 Da.
    Residues 156 Isoelectric Point 6.71
    Sequence mtimltpmqteefrsyltyttkhyaeekvkagtwlpedaqllskqvftdllprgletphhhlwslklne kdivgwlwihaepehpqqeafiydfglyepyrgkgyakqalaaldqaarsmgirklslhvfahnqtark lyeqtgfqetdvvmskkl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.25894
    Matthews' coefficent 2.90 Rfactor 0.23252
    Waters 81 Solvent Content 57.26

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1ufh
    1. FATCAT: a web server for flexible structure comparison and structure similarity searching
    Y Ye, A Godzik - Nucleic acids research, 2004 - Oxford Univ Press
     
    2. Structural analysis of a set of proteins resulting from a bacterial genomics project
    J Badger, JM Sauder, JM Adams - Proteins: Structure, , 2005 - Wiley Online Library
     
    3. Database searching by flexible protein structure alignment
    Y Ye, A Godzik - Protein science, 2004 - Wiley Online Library
     
    4. Are structural biases at protein termini a signature of vectorial folding?
    A Laio, C Micheletti - PROTEINS: Structure, Function, and , 2006 - Wiley Online Library
     
    5. Structure of the bacillus subtilis YYCN protein: A putative N_acetyltransferase
    B Taneja, S Maar, L Shuvalova, F Collart - Proteins: Structure, , 2003 - Wiley Online Library
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch