.
The Open Protein Structure Annotation Network
PDB Keyword
.

1u7i

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of hypothetical protein PA1358 from Pseudomonas aeruginosa. To be Published
    Site MCSG
    PDB Id 1u7i Target Id APC5542
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS4682,AAG04747, 208964 Molecular Weight 14700.84 Da.
    Residues 132 Isoelectric Point 4.86
    Sequence msarvrpflmfqgvqaeaamnfylslfddaeilqiqrygaegpgpegsvlkalfrlgdqsvhcidshvr hafdftpafsffvdcesnaqierlaealsdggkalmplgdygfsqrfawladrfgvswqlnla
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.40 Rfree 0.17564
    Matthews' coefficent 2.50 Rfactor 0.14719
    Waters 365 Solvent Content 50.60

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1u7i
    1. PIEEfficient filters and coarse grained potentials for unbound proteinprotein docking
    DVS Ravikant, R Elber - Proteins: Structure, Function, and , 2010 - Wiley Online Library
     
    2. Atomic resolution structure of EhpR: phenazine resistance in Enterobacter agglomerans Eh1087 follows principles of bleomycin/mitomycin C resistance in
    S Yu, A Vit, S Devenish, HK Mahanty - BMC structural , 2011 - biomedcentral.com
     
    3. Protein structure prediction based on the sliced lattice model
    CC Wang, CB Yang, HY Ann - 2008 Conference on , 2005 - etd.lib.nsysu.edu.tw
     
    4. Prediction of Protein Backbone Based on the Sliced Lattice Model
    CC Wang, CB Yang, HY Ann, HY Chang - 2008 - csie.npu.edu.tw
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch