.
The Open Protein Structure Annotation Network
PDB Keyword
.

1u69

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 1.6 A crystal structure of a PA2721 protein from pseudomonas aeruginosa--a potential drug-resistance protein. Proteins 63 1102-1105 2006
    Site MCSG
    PDB Id 1u69 Target Id APC5038
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS4649,AAG06109, 208964 Molecular Weight 17355.54 Da.
    Residues 159 Isoelectric Point 4.80
    Sequence mnsknticlwydsaaleaatfyaetfpdsavlavhrapgdypsgkegdvltvefrvmgipclglnggpa frhseafsfqvatddqaetdrlwnaivdnggeesacgwcrdkwgiswqitprvlseaiaspdraaarra feammtmgridiatiekafkg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.60 Rfree 0.193
    Matthews' coefficent 2.17 Rfactor 0.172
    Waters 544 Solvent Content 0.43

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1u69
    1. Atomic resolution structure of EhpR: phenazine resistance in Enterobacter agglomerans Eh1087 follows principles of bleomycin/mitomycin C resistance in
    S Yu, A Vit, S Devenish, HK Mahanty - BMC structural , 2011 - biomedcentral.com
     
    2. 1.6 Crystal structure of a PA2721 protein from pseudomonas aeruginosaA potential drug_resistance protein
    B Nocek, M Cuff, E Evdokimova - Proteins: Structure, , 2006 - Wiley Online Library
     
    3. Protein structure prediction based on the sliced lattice model
    CC Wang, CB Yang, HY Ann - 2008 Conference on , 2005 - etd.lib.nsysu.edu.tw
     
    4. Prediction of Protein Backbone Based on the Sliced Lattice Model
    CC Wang, CB Yang, HY Ann, HY Chang - 2008 - csie.npu.edu.tw
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch