.
The Open Protein Structure Annotation Network
PDB Keyword
.

1u60

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Functional and structural characterization of four glutaminases from Escherichia coli and Bacillus subtilis. Biochemistry 47 5724-5735 2008
    Site MCSG
    PDB Id 1u60 Target Id APC5046
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS4656,AAC73587, 562 Molecular Weight 32901.53 Da.
    Residues 310 Isoelectric Point 4.81
    Sequence mldanklqqavdqaytqfhslnggqnadyipflanvpgqlaavaivtcdgnvysagdsdyrfalesisk vctlalaledvgpqavqdkigadptglpfnsvialelhggkplsplvnagaiattslinaenveqrwqr ilhiqqqlageqvalsdevnqseqttnfhnraiawllysagylycdameacdvytrqcstllntielat lgatlaaggvnplthkrvlqadnvpyilaemmmeglygrsgdwayrvglpgksgvgggilavvpgvmgi aafsppldedgnsvrgqkmvasvakqlgynvfkg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.61 Rfree 0.17761
    Matthews' coefficent 2.45 Rfactor 0.14295
    Waters 1150 Solvent Content 49.85

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 12;FMT (FORMIC) x 9
    Metals

    Jmol

     
    Google Scholar output for 1u60
    1. Fast and accurate algorithms for protein side-chain packing
    J Xu, B Berger - Journal of the ACM (JACM), 2006 - dl.acm.org
     
    2. Functional and Structural Characterization of Four Glutaminases from Escherichia coli and Bacillus subtilis
    G Brown, A Singer, M Proudfoot, T Skarina, Y Kim - Biochemistry, 2008 - ACS Publications
     
    3. Crystal structure of a major fragment of the salt-tolerant glutaminase from Micrococcus luteus K-3
    K Yoshimune, Y Shirakihara, A Shiratori - Biochemical and , 2006 - Elsevier
     
    4. Crystal structure of salt_tolerant glutaminase from Micrococcus luteus K_3 in the presence and absence of its product l_glutamate and its activator Tris
    K Yoshimune, Y Shirakihara, M Wakayama - FEBS , 2010 - Wiley Online Library
     
    5. Analysis of essential amino acid residues for catalytic activity of glutaminase from Micrococcus luteus K-3
    S Yano, A Kamemura, K Yoshimune - Journal of bioscience , 2006 - Elsevier
     
    6. Protein structure prediction based on the sliced lattice model
    CC Wang, CB Yang, HY Ann - 2008 Conference on , 2005 - etd.lib.nsysu.edu.tw
     
    7. Investigating diproline segments in proteins: Occurrences, conformation and classification
    I Saha, N Shamala - Biopolymers, 2012 - Wiley Online Library
     
    8. Prediction of Protein Backbone Based on the Sliced Lattice Model
    CC Wang, CB Yang, HY Ann, HY Chang - 2008 - csie.npu.edu.tw
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch