.
The Open Protein Structure Annotation Network
PDB Keyword
.

1tu9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of PA3967 from Pseudomonas aeruginosa PAO1, a Hypothetical Protein which is highly homologous to human Hemoglobin in structure. To be Published
    Site MCSG
    PDB Id 1tu9 Target Id APC5032
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS4644,AAG07354, 208964 Molecular Weight 14703.99 Da.
    Residues 130 Isoelectric Point 7.76
    Sequence mnaadrvmqsygrccastgffddfyrhflasspqirakfattdmtaqkhllragimnlvmyargmsdsk lralgashsraaldirpelydlwldallmavaehdrdcdaetrdawrdvmgrgiaviksyy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.20 Rfree 0.19057
    Matthews' coefficent 2.50 Rfactor 0.16118
    Waters 272 Solvent Content 50.70

    Ligand Information
    Ligands HEM-PPI (PROTOPORPHYRIN) x 1;EDO (PROPANOIC) x 2
    Metals

    Jmol

     
    Google Scholar output for 1tu9
    1. Similarity search for local protein structures at atomic resolution by exploiting a database management system
    AR Kinjo, H Nakamura - Biophysics, 2007 - J-STAGE
     
    2. Quantum Chemical Investigations on Intraresidue Carbonyl_ Carbonyl Contacts in Aspartates of High-Resolution Protein Structures
    TK Pal, R Sankararamakrishnan - The Journal of Physical , 2009 - ACS Publications
     
    3. Docking to heme proteins
    UF Rhrig, A Grosdidier, V Zoete - Journal of , 2009 - Wiley Online Library
     
    4. A contact map matching approach to protein structure similarity analysis
    RC De Melo, CE Lopes, FA Fernandes Jr - Genet. Mol. , 2006 - homepages.dcc.ufmg.br
     
    5. An automatic method for assessing structural importance of amino acid positions
    M Sadowski, D Jones - BMC structural biology, 2009 - biomedcentral.com
     
    6. Modelling Protein Structure Using Discrete Backbone Torsion Angles
    P Smith - 2010 - unsworks.unsw.edu.au
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch