.
The Open Protein Structure Annotation Network
PDB Keyword
.

1to9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of THI-4 protein from Bacillus subtilis. To be Published
    Site MCSG
    PDB Id 1to9 Target Id APC1217
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS4515,P25052, 1423 Molecular Weight 27415.23 Da.
    Residues 236 Isoelectric Point 5.16
    Sequence mkfseecrsaaaewwegsfvhpfvqgigdgtlpidrfkyyvlqdsyylthfakvqsfgaayakdlyttg rmashaqgtyeaemalhrefaelleiseeerkafkpsptaysytshmyrsvlsgnfaeilaallpcywl yyevgekllhcdpghpiyqkwigtyggdwfrqqveeqinrfdelaensteevrakmkenfvissyyeyq fwgmayrkegwsdsaikeveecgasrhng
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.40 Rfree 0.25689
    Matthews' coefficent 2.22 Rfactor 0.21017
    Waters 29 Solvent Content 44.66

    Ligand Information
    Ligands HMH (4-AMINO-5-HYDROXYMETHYL-2-METHYLPYRIMIDINE) x 2
    Metals

    Jmol

     
    Google Scholar output for 1to9
    1. An iterative knowledge_based scoring function for proteinprotein recognition
    SY Huang, X Zou - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     
    2. Structural characterization of the regulatory proteins TenA and TenI from Bacillus subtilis and identification of TenA as a thiaminase II
    V Angela, AL Haas, JH Park, TP Begley, SE Ealick - Biochemistry, 2005 - ACS Publications
     
    3. Structural and mutational analysis of TenA protein (HP1287) from the Helicobacter pylori thiamin salvage pathwayevidence of a different substrate specificity
    N Barison, L Cendron, A Trento, A Angelini - FEBS , 2009 - Wiley Online Library
     
    4. SYSTEM AND USES FOR GENERATING DATABASES OF PROTEIN SECONDARY STRUCTURES INVOLVED IN INTER-CHAIN PROTEIN INTERACTIONS
    AL Jochim, PS Arora - US Patent App. 12/753,638, 2010 - Google Patents
     
    5. Structural analysis of monomeric isocitrate dehydrogenase from corynebacterium glutamicum
    F Imabayashi - 2004 - library.usask.ca
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch