| Title | Crystal Structure of Conserved Hypothetical Protein SSO0622 from Sulfolobus solfataricus. To be Published | | Site | MCSG | | PDB Id | | Target Id | APC3600 | | Molecular Characteristics | | Source | Sulfolobus solfataricus | | Alias Ids | TPS4592,Q9UX16, 2287 | Molecular Weight | 24113.73 Da. | | Residues | 209 | Isoelectric Point | 9.37 | | Sequence | mlvweelrekalnkiyhdkeigyldpdilgfllafyrnrndvytqsscsgritivdaempwdrknstii fknhlriteqdledvlsknqvrrlwlivqgpiihiyaknietgwdilkiareagfkhsgilatnqkgvl velrtgirmvhllresntervdkdkiktlvnvcnevlargkqkmnllkdllssssnnsmelgknsklktpi | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 2.80 | Rfree | 0.2716 | | Matthews' coefficent | 2.80 | Rfactor | 0.2232 | | Waters | 247 | Solvent Content | 0.56 |
| Ligand Information | | Ligands | SO4 (SULFATE) x 3 | | Metals | | | |
