.
The Open Protein Structure Annotation Network
PDB Keyword
.

1tf1

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural and biochemical study of effector molecule recognition by the E.coli glyoxylate and allantoin utilization regulatory protein AllR. J.Mol.Biol. 358 810-828 2006
    Site MCSG
    PDB Id 1tf1 Target Id APC5051
    Molecular Characteristics
    Source Escherichia coli o157:h7 edl933
    Alias Ids TPS4661,NP_286254, 155864 Molecular Weight 29268.02 Da.
    Residues 271 Isoelectric Point 5.77
    Sequence mtevrrrgrpgqaepvaqkgaqalergiailqyleksggsssvsdislnldlplsttfrllkvlqaadf vyqdsqlgwwhiglgvfnvgaayihnrdvlsvagpfmrrlmllsgetvnvairngneavligqlecksm vrmcaplgsrlplhasgagkallyplaeeelmsiilqtglqqftpttlvdmptllkdleqarelgytvd keehvvglnciasaiyddvgsvvaaisisgpssrltedrfvsqgelvrdtardistalglkahp
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.80 Rfree 0.257
    Matthews' coefficent 2.18 Rfactor 0.214
    Waters 595 Solvent Content 43.56

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1tf1
    1. Biomolecular networks: methods and applications in systems biology
    L Chen, RS Wang, XS Zhang - 2009 - books.google.com
     
    2. Members of the IclR family of bacterial transcriptional regulators function as activators and/or repressors
    AJ Molina_Henares, T Krell - FEMS microbiology , 2006 - Wiley Online Library
     
    3. Glyoxylate and pyruvate are antagonistic effectors of the Escherichia coli IclR transcriptional regulator
    GL Lorca, A Ezersky, VV Lunin, JR Walker - Journal of Biological , 2007 - ASBMB
     
    4. Structure of the Parkin in-between-ring domain provides insights for E3-ligase dysfunction in autosomal recessive Parkinson's disease
    SA Beasley, VA Hristova - Proceedings of the , 2007 - National Acad Sciences
     
    5. The IclR family of transcriptional activators and repressors can be defined by a single profile
    T Krell, AJ Molina_Henares, JL Ramos - Protein science, 2006 - Wiley Online Library
     
    6. Structural and biochemical study of effector molecule recognition by the E. coli glyoxylate and allantoin utilization regulatory protein AllR
    JR Walker, S Altamentova, A Ezersky, G Lorca - Journal of molecular , 2006 - Elsevier
     
    7. Efficient protein tertiary structure retrievals and classifications using content based comparison algorithms
    PH Chi - 2007 - mospace.umsystem.edu
     
    8. Different Modes of Binding of Mono-and Biaromatic Effectors to the Transcriptional Regulator TTGV
    ME Guazzaroni, MT Gallegos, JL Ramos - Journal of Biological , 2007 - ASBMB
     
    9. Structural and functional characterization of IclR transcription regulators
    A Ezersky - 2009 - 142.150.190.46
     
    10. Bases moleculares de la tolerancia a disolventes orgnicos: estudio de la regulacin de la bomba de expulsin de disolventes TtgGHI en Pseudomonas
    ME Guazzaroni - 2007 - 0-hera.ugr.es.adrastea.ugr.es
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch