.
The Open Protein Structure Annotation Network
PDB Keyword
.

1te2

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title Crystal Structure of Putative Phosphatase Ynic from Escherichia coli K12. To be Published
    Site MCSG
    PDB Id 1te2 Target Id APC5035
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS4646,NP_754020, 562 Molecular Weight 24299.77 Da.
    Residues 222 Isoelectric Point 4.78
    Sequence mstprqilaaifdmdgllidseplwdraeldvmaslgvdisrrnelpdtlglridmvvdlwyarqpwng psrqevveqviaraislveetrpllpgvreavalckeqgllvglasasplhmlekvltmfdlrdsfdal asaeklpyskphpqvyldcaaklgvdpltcvaledsvngmiaskaarmrsivvpapeaqndprfvlanv klsslteltakdllg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.76 Rfree 0.21964
    Matthews' coefficent 2.12 Rfactor 0.17416
    Waters 637 Solvent Content 42.00

    Ligand Information
    Ligands PGA (2-PHOSPHOGLYCOLIC) x 2
    Metals CA (CALCIUM) x 4

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch