.
The Open Protein Structure Annotation Network
PDB Keyword
.

1td5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structural Analyses of the Ligand Binding Sites of the IclR family of transcriptional regulators. To be Published
    Site MCSG
    PDB Id 1td5 Target Id APC5050
    Molecular Characteristics
    Source Escherichia coli o157:h7 edl933
    Alias Ids TPS4660,NP_290645, 155864 Molecular Weight 31256.51 Da.
    Residues 287 Isoelectric Point 8.76
    Sequence mkmistiqkketvmvapipakrgrkpavatapatgqvqsltrglkllewiaesngsvaltelaqqaglp nstthrllttmqqqgfvrqvgelghwaigahafmvgssflqsrnllaivhpilrnlmeesgetvnmavl dqsdheaiiidqvqcthlmrmsapiggklpmhasgagkaflaqlseeqvtkllhrkglhaythatlvsp vhlkedlaqtrkrgysfddeehalglrclaacifdehrepfaaisisgpisritddrvtefgamvikaa kevtlayggmr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.30 Rfree 0.299
    Matthews' coefficent 2.30 Rfactor 0.23
    Waters 335 Solvent Content 46.60

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1td5
    1. Members of the IclR family of bacterial transcriptional regulators function as activators and/or repressors
    AJ Molina_Henares, T Krell - FEMS microbiology , 2006 - Wiley Online Library
     
    2. Towards fully automated structure-based function prediction in structural genomics: a case study
    JD Watson, S Sanderson, A Ezersky - Journal of molecular , 2007 - Elsevier
     
    3. Glyoxylate and pyruvate are antagonistic effectors of the Escherichia coli IclR transcriptional regulator
    GL Lorca, A Ezersky, VV Lunin, JR Walker - Journal of Biological , 2007 - ASBMB
     
    4. Structural and biochemical study of effector molecule recognition by the E. coli glyoxylate and allantoin utilization regulatory protein AllR
    JR Walker, S Altamentova, A Ezersky, G Lorca - Journal of molecular , 2006 - Elsevier
     
    5. Different Modes of Binding of Mono-and Biaromatic Effectors to the Transcriptional Regulator TTGV
    ME Guazzaroni, MT Gallegos, JL Ramos - Journal of Biological , 2007 - ASBMB
     
    6. Structural and functional characterization of IclR transcription regulators
    A Ezersky - 2009 - 142.150.190.46
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch