.
The Open Protein Structure Annotation Network
PDB Keyword
.
Blog
Tools
About
Logged in: Logged in as: Log in
Register

New Features

Quick Links

 

T. maritima Browser

TOPSAN > Proteins > MCSG > 1t9k

1t9k

    Page last modified 00:58, 25 Sep 2010 by Admin
    Email link
    Page Notifications Off
    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title X-ray crystal structure of aIF-2B translation initiation factor from Thermotoga maritima. To be Published
    Site MCSG
    PDB Id 1t9k Target Id APC4470
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS4606,AAD35992, 2336 Molecular Weight 38047.90 Da.
    Residues 343 Isoelectric Point 5.98
    Sequence mklktktmewsgnslklldqrklpfieeyvecktheevahaikemivrgapaigvaaafgyvlglrdyk tgsltdwmkqvketlartrptavnlfwalnrmekvffenadrenlfeilenealkmayedievnkaigk ngaqlikdgstilthcnagalatvdygtalgviraavesgkrirvfadetrpylqgarltawelmkdgi evyvitdnmagwlmkrglidavvvgadrialngdtankigtyslavlakrnnipfyvaapvstidptir sgeeipieerrpeevthcggnriapegvkvlnpafdvtentlitaiitekgvirppfeenikkilev
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.60 Rfree 0.298
    Matthews' coefficent 2.66 Rfactor 0.239
    Waters 198 Solvent Content 52.98

    Pathway

    Reactions found in Metabolic Reconstruction for TM0911
    Name: 5-methylthioribose-1-phosphate isomerase irreversible
    Metabolic Subsystem: Methionine Metabolism
    Reaction: : 5mdr1p --> 5mdru1p
    Classification: EC:5.3.1.23
     

    Ligand Information
    Ligands SO4 (SULFATE) x 4
    Metals CL (CHLORIDE) x 2

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews References Images Files Tags

    Reviews

    References

     

    No references found.

    Add tag
    Tag page
    What links here
    Attach file or image

    Files (0)

     
    Attach file or image

    Images (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch