.
The Open Protein Structure Annotation Network
PDB Keyword
.

1t8q

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of Glycerophosphoryl diester phosphodiesterase from E. coli. To be Published
    Site MCSG
    PDB Id 1t8q Target Id APC172
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS4460,P09394, 562 Molecular Weight 40841.33 Da.
    Residues 358 Isoelectric Point 5.38
    Sequence mkltlknlsmaimmstivmgssamaadsnekiviahrgasgylpehtlpakamayaqgadyleqdlvmt kddnlvvlhdhyldrvtdvadrfpdrarkdgryyaidftldeikslkftegfdiengkkvqtypgrfpm gksdfrvhtfeeeiefvqglnhstgknigiypeikapwfhhqegkdiaaktlevlkkygytgkddkvyl qcfdadelkriknelepkmgmelnlvqliaytdwnetqqkqpdgswvnynydwmfkpgamkqvaeyadg igpdyhmlieetsqpgnikltgmvqdaqqnklvvhpytvrsdklpeytpdvnqlydalynkagvnglft dfpdkavkflnke
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.00 Rfree 0.265
    Matthews' coefficent 2.96 Rfactor 0.233
    Waters 1160 Solvent Content 56.80

    Ligand Information
    Ligands GOL (GLYCEROL) x 11
    Metals MG (MAGNESIUM) x 4

    Jmol

     
    Google Scholar output for 1t8q
    1. Lateral gene transfer of a dermonecrotic toxin between spiders and bacteria
    MHJ Cordes, GJ Binford - Bioinformatics, 2006 - Oxford Univ Press
     
    2. Crystal structure of glycerophosphodiester phosphodiesterase from Agrobacterium tumefaciens by SAD with a large asymmetric unit
    KN Rao, JB Bonanno, SK Burley - Proteins: Structure, , 2006 - Wiley Online Library
     
    3. Crystal structure of glycerophosphodiester phosphodiesterase (GDPD) from Thermoanaerobacter tengcongensis, a metal ion_dependent enzyme: Insight into the
    L Shi, JF Liu, XM An, DC Liang - Proteins: Structure, Function, , 2008 - Wiley Online Library
     
    4. Escherichia coli cytosolic glycerophosphodiester phosphodiesterase (UgpQ) requires Mg2+, Co2+, or Mn2+ for its enzyme activity
    N Ohshima, S Yamashita, N Takahashi - Journal of , 2008 - Am Soc Microbiol
     
    5. Isolation, characterization and molecular 3D model of human GDE4, a novel membrane protein containing glycerophosphodiester phosphodiesterase domain
    PA Chang, HB Shao, DX Long - Molecular Membrane , 2008 - informahealthcare.com
     
    6. Membrane transport metabolons
    TF Moraes, RAF Reithmeier - Biochimica et Biophysica Acta (BBA)- , 2012 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch