| Title | X-ray crystal structure of hypothetical protein (RBSTP2229 gene product) from Bacillus stearothermophilus. To be Published | | Site | MCSG | | PDB Id | | Target Id | APC35969 | | Molecular Characteristics | | Source | Bacillus stearothermophilus | | Alias Ids | TPS5530,RBSTP2229, 1422 | Molecular Weight | 13810.18 Da. | | Residues | 125 | Isoelectric Point | 7.96 | | Sequence | mntdlklpagktmtiedvkqlleryqmalkktgeqlgwayeqaafpytvrihesvlylqgdgrlykgma isvrtageetfidialppgathgdkgkanefskwlaktlggelhlfsgrtmvfgsa | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 2.05 | Rfree | 0.22462 | | Matthews' coefficent | 4.10 | Rfactor | 0.19429 | | Waters | 100 | Solvent Content | 69.70 |
| Ligand Information | | Ligands | NO3 (NITRATE) x 1 | | Metals | | | |
