.
The Open Protein Structure Annotation Network
PDB Keyword
.

1t1j

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Conserved Hypothetical Protein PA1492 from Pseudomonas aeruginosa. TO BE PUBLISHED
    Site MCSG
    PDB Id 1t1j Target Id APC5043
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS4653,AAG04881, 208964 Molecular Weight 13488.71 Da.
    Residues 118 Isoelectric Point 5.29
    Sequence mrkiflacpyshadaevveqrfracnevaativraghvvfsqvsmshpinlclaeldraaigrlwapvd afymdhleelivldlpgwrdsagirremeffeaggqrvslwsevehefr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.70 Rfree 0.229
    Matthews' coefficent 2.76 Rfactor 0.202
    Waters 146 Solvent Content 55.10

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1t1j
    1. The Sorcerer II Global Ocean Sampling expedition: expanding the universe of protein families
    S Yooseph, G Sutton, DB Rusch, AL Halpern - PLoS biology, 2007 - dx.plos.org
     
    2. Data growth and its impact on the SCOP database: new developments
    A Andreeva, D Howorth, JM Chandonia - Nucleic acids , 2008 - Oxford Univ Press
     
    3. Low-resolution molecular dynamics simulations of the 30S ribosomal subunit
    Q Cui, RKZ Tan, SC Harvey, DA Case - 2006 - smartech.gatech.edu
     
    4. Protein structural classification and family identification by multifractal analysis and wavelet spectrum
    SM Zhu, ZG Yu, A Vo - Chinese Physics B, 2011 - iopscience.iop.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch