| Title | The crystal structure of the protein CheX from Thermotoga maritima. To be Published | | Site | MCSG | | PDB Id | | Target Id | APC4842 | | Molecular Characteristics | | Source | Thermotoga maritima | | Alias Ids | TPS4626,AAD36685, 2336 | Molecular Weight | 16448.20 Da. | | Residues | 155 | Isoelectric Point | 5.47 | | Sequence | mdarivnaligsvyetirdvlgiepktgkpstvshieiphslvtvigitggiegsliysfssetalkvv sammggmeynqldelalsaigelgnmtagklamklehlgkhvditpptvvsgrdlkiksfgvilklpis vfseedfdlhlsvksgg | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 2.40 | Rfree | 0.32 | | Matthews' coefficent | 2.40 | Rfactor | 0.239 | | Waters | 5 | Solvent Content | 48.71 |
| Ligand Information | | Ligands | | | Metals | | | |
