.
The Open Protein Structure Annotation Network
PDB Keyword
.

1sqe

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Staphylococcus aureus IsdG and IsdI, heme-degrading enzymes with structural similarity to monooxygenases. J.Biol.Chem. 280 2840-2846 2005
    Site MCSG
    PDB Id 1sqe Target Id APC006
    Molecular Characteristics
    Source Staphylococcus aureus
    Alias Ids TPS4408,NP_370689, 1280 Molecular Weight 12790.61 Da.
    Residues 108 Isoelectric Point 4.87
    Sequence mfmaenrlqlqkgsaeetierfynrqgietiegfqqmfvtktlntedtdevkiltiwesedsfnnwlns dvfkeahknvrlksdddgqqspilsnkvfkydigyhyqk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.50 Rfree 0.245
    Matthews' coefficent 2.04 Rfactor 0.203
    Waters 231 Solvent Content 39.68

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 1sqe
    1. High-throughput crystallography for structural genomics
    A Joachimiak - Current opinion in structural biology, 2009 - Elsevier
     
    2. An iterative knowledge_based scoring function for proteinprotein recognition
    SY Huang, X Zou - Proteins: Structure, Function, and , 2008 - Wiley Online Library
     
    3. Ruffling of metalloporphyrins bound to IsdG and IsdI, two heme-degrading enzymes in Staphylococcus aureus
    WC Lee, ML Reniere, EP Skaar, MEP Murphy - Journal of Biological , 2008 - ASBMB
     
    4. A novel chimera: The truncated hemoglobin-antibiotic monooxygenase from Streptomyces avermitilis
    A Bonamore, A Attili, F Arenghi, B Catacchio - Gene, 2007 - Elsevier
     
    5. Chlorite dismutases, DyPs, and EfeB: 3 microbial heme enzyme families comprise the CDE structural superfamily
    B Goblirsch, RC Kurker, BR Streit, CM Wilmot - Journal of molecular , 2011 - Elsevier
     
    6. The crystal structure of Rv0793, a hypothetical monooxygenase from M._ tuberculosis
    MJ Lemieux, C Ference, MM Cherney, M Wang - Journal of structural and , 2005 - Springer
     
    7. Structural insight of the role of the Hahella chejuensis HapK protein in prodigiosin biosynthesis
    HJ Cho, KJ Kim, MH Kim - : Structure, Function, and , 2008 - Wiley Online Library
     
    8. Protein structural classification and family identification by multifractal analysis and wavelet spectrum
    SM Zhu, ZG Yu, A Vo - Chinese Physics B, 2011 - iopscience.iop.org
     
    9. TA Binkowski, A Joachimiak - BMC structural biology, 2008 - BioMed Central Ltd
    30
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch