| Title | 1.5A crystal structure of a hypothetical protein PA5026 from Pseudomonas aeruginosa. To be Published | | Site | MCSG | | PDB Id | | Target Id | APC5037 | | Molecular Characteristics | | Source | Pseudomonas aeruginosa pa01 | | Alias Ids | TPS4648,AAG08411, 208964 | Molecular Weight | 16785.22 Da. | | Residues | 150 | Isoelectric Point | 5.97 | | Sequence | mplptelarhlteekiafvqrsglraevlepgyvrlrmpgagnenhigsmyagalftlaelpggalflt sfdsarfypivkemtlrfrrpakgdirvearldaerirqleteagergkaeyslelqltdeqgevvaes aalyqlrsharp | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 1.50 | Rfree | 0.217 | | Matthews' coefficent | 2.80 | Rfactor | 0.197 | | Waters | 332 | Solvent Content | 55.73 |
| Ligand Information | | Ligands | | | Metals | | | |
