.
The Open Protein Structure Annotation Network
PDB Keyword
.

1sf9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Bacillus Subtilis YfhH hypothetical protein. To be Published
    Site MCSG
    PDB Id 1sf9 Target Id APC1145
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS4504,O31576, 1423 Molecular Weight 12008.85 Da.
    Residues 104 Isoelectric Point 4.86
    Sequence mekrysqmtphelnteiallsekarkaeqhgiinelavlerkitmakayllnpedyspgetyrvented eftisylngvfawgyrtsspqqeealpisvlqeke
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.71 Rfree 0.2038
    Matthews' coefficent 2.00 Rfactor 0.1715
    Waters 188 Solvent Content 38.00

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 1;PT (PLATINUM) x 1

    Jmol

     
    Google Scholar output for 1sf9
    1. Structure and activity of Y-class DNA polymerase Dpo4 from Sulfolobus solfataricus with templates containing the hydrophobic thymine analog 2, 4-difluorotoluene
    A Irimia, RL Eoff, PS Pallan, FP Guengerich - Journal of Biological , 2007 - ASBMB
     
    2. HSEpred: predict half-sphere exposure from protein sequences
    J Song, H Tan, K Takemoto, T Akutsu - Bioinformatics, 2008 - Oxford Univ Press
     
    3. A fold-recognition approach to loop modeling
    C Levefelt, D Lundh - Journal of molecular modeling, 2006 - Springer
     
    4. Interactions Between Proteins and Platinum-Containing Anti-Cancer Drugs
    C Bischin, A Lupan, V Taciuc - Mini Reviews in , 2011 - ingentaconnect.com
     
    5. Protein structure prediction based on the sliced lattice model
    CC Wang, CB Yang, HY Ann - 2008 Conference on , 2005 - etd.lib.nsysu.edu.tw
     
    6. Prediction of Protein Backbone Based on the Sliced Lattice Model
    CC Wang, CB Yang, HY Ann, HY Chang - 2008 - csie.npu.edu.tw
     
    7. Modelling Protein Structure Using Discrete Backbone Torsion Angles
    P Smith - 2010 - unsworks.unsw.edu.au
     
    8. Investigation of the structure and function of type III secretion needle and tip proteins
    L Zhang - 2009 - kuscholarworks.ku.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch