.
The Open Protein Structure Annotation Network
PDB Keyword
.

1sed

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The Crystal Structure of the Hypothetical Protein YhaI, APC1180 from Bacillus subtilis. To be Published
    Site MCSG
    PDB Id 1sed Target Id APC1180
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS4511,O07517, 1423 Molecular Weight 13305.63 Da.
    Residues 113 Isoelectric Point 4.51
    Sequence mdsmdhrierleyyiqllvktvdmdrypfyallidkglskeegeavmricdelseelatqkaqgfvtfd kllalfagqlnekldvhetifalyeqglyqelmevfidimkhfd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 3
    Resolution (Å) 2.10 Rfree 0.209
    Matthews' coefficent 4.52 Rfactor 0.189
    Waters 233 Solvent Content 72.56

    Ligand Information
    Ligands MPD ((4S)-2-METHYL-2,4-PENTANEDIOL) x 17;GOL (GLYCEROL) x 6
    Metals ZN (ZINC) x 3;NA (SODIUM) x 3

    Jmol

     
    Google Scholar output for 1sed
    1. Protein function prediction using local 3D templates
    RA Laskowski, JD Watson, JM Thornton - Journal of Molecular Biology, 2005 - Elsevier
     
    2. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     
    3. SINGLE-CHAIN ANTIPARALLEL COILED COIL PROTEINS
    J Desmet, IJI Lasters, S Loverix - US Patent 20,110,294,983, 2011 - freepatentsonline.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch