.
The Open Protein Structure Annotation Network
PDB Keyword
.

1s5u

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Hypothetical Protein EC709 from Escherichia coli. To be Published
    Site MCSG
    PDB Id 1s5u Target Id APC5029
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS4642,NP_286464, 562 Molecular Weight 15561.24 Da.
    Residues 134 Isoelectric Point 6.91
    Sequence mnttlfrwpvrvyyedtdaggvvyhasyvafyerartemlrhhhfsqqalmaervafvvrkmtveyyap arlddmleiqteitsmrgtslvftqrivnaentllneaevlvvcvdplkmkpralpksivaefkq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.70 Rfree 0.23
    Matthews' coefficent 2.15 Rfactor 0.2
    Waters 748 Solvent Content 42.85

    Ligand Information
    Ligands SO4 (SULFATE) x 12;EDO (1,2-ETHANEDIOL) x 5
    Metals

    Jmol

     
    Google Scholar output for 1s5u
    1. A protein network for phospholipid synthesis uncovered by a variant of the tandem affinity purification method in Escherichia coli
    D Gully, E Bouveret - Proteomics, 2006 - Wiley Online Library
     
    2. A structural model of the plant acyl-acyl carrier protein thioesterase FatB comprises two helix/4-stranded sheet domains, the N-terminal domain containing residues
    KM Mayer, J Shanklin - Journal of Biological Chemistry, 2005 - ASBMB
     
    3. Divergence of Function in the Hot Dog Fold Enzyme Superfamily: The Bacterial Thioesterase YciA
    Z Zhuang, F Song, H Zhao, L Li, J Cao, E Eisenstein - Biochemistry, 2008 - ACS Publications
     
    4. Thioesterases: A new perspective based on their primary and tertiary structures
    DC Cantu, Y Chen, PJ Reilly - Protein Science, 2010 - Wiley Online Library
     
    5. Preferential Hydrolysis of Aberrant Intermediates by the Type II Thioesterase in Escherichia coli Nonribosomal Enterobactin Synthesis: Substrate Specificities and
    ZF Guo, Y Sun, S Zheng, Z Guo - Biochemistry, 2009 - ACS Publications
     
    6. Structural and enzymatic characterization of HP0496, a YbgC thioesterase from Helicobacter pylori
    A Angelini, L Cendron, S Goncalves - Proteins: Structure, , 2008 - Wiley Online Library
     
    7. Analysis of proteins with the'hot dog'fold: Prediction of function and identification of catalytic residues of hypothetical proteins
    LS Pidugu, K Maity, K Ramaswamy - BMC structural , 2009 - biomedcentral.com
     
    8. Structure and function of a Campylobacter jejuni thioesterase Cj0915, a hexameric hot dog fold enzyme
    T Yokoyama, KJ Choi, AM Bosch, HJ Yeo - Biochimica et Biophysica Acta ( , 2009 - Elsevier
     
    9. Function-Biased Choice of Additives for Optimization of Protein Crystallization: The Case of the Putative Thioesterase PA5185 from Pseudomonas aeruginosa PAO1
    M Chruszcz, MD Zimmerman, S Wang - Crystal Growth and , 2008 - ACS Publications
     
    10. Structure and activity of the Pseudomonas aeruginosa hotdog-fold thioesterases PA5202 and PA2801
    FG Claudio, T Anatoli, B Greg, F Robert, E Elena - Biochemical , 2012 - biochemj.org
     
    11. Structure and activity of the Pseudomonas aeruginosa hotdog-fold thioesterases PA5202 and PA2801
    CF Gonzalez, A Tchigvintsev, G Brown, R Flick - Biochemical , 2012 - 82.45.151.66
     
    12. STRUCTURE TO FUNCTION: CASE STUDIES OF HOTDOG-FOLD SUPERFAMILY THIOESTERASES FROM ESCHERICHIA COLI
    JA Latham - 2012 - repository.unm.edu
     
    13. Structure of the putative thioesterase protein TTHA1846 from Thermus thermophilus HB8 complexed with coenzyme A and a zinc ion
    T Hosaka, K Murayama, M Kato-Murayama - Section D: Biological , 2009 - scripts.iucr.org
     
    14. Structure and activity of the {Less than} i {Greater than} Pseudomonas aeruginosa {Less than}/i {Greater than} hotdog-fold thioesterases PA5202 and PA2801
    C Gonzalez, A Tchigvintsev, G Brown, R Flick - 2012 - biochemj.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch