| Title | Crystal Structure of Hypothetical Protein EC709 from Escherichia coli. To be Published | | Site | MCSG | | PDB Id | | Target Id | APC5029 | | Molecular Characteristics | | Source | Escherichia coli | | Alias Ids | TPS4642,NP_286464, 562 | Molecular Weight | 15561.24 Da. | | Residues | 134 | Isoelectric Point | 6.91 | | Sequence | mnttlfrwpvrvyyedtdaggvvyhasyvafyerartemlrhhhfsqqalmaervafvvrkmtveyyap arlddmleiqteitsmrgtslvftqrivnaentllneaevlvvcvdplkmkpralpksivaefkq | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 4 | | Resolution (Å) | 1.70 | Rfree | 0.23 | | Matthews' coefficent | 2.15 | Rfactor | 0.2 | | Waters | 748 | Solvent Content | 42.85 |
| Ligand Information | | Ligands | SO4 (SULFATE) x 12;EDO (1,2-ETHANEDIOL) x 5 | | Metals | | | |
