| Title | Structure of hypothetical protein RBSTP0775 from Bacillus stearothermophilus. To be Published | | Site | MCSG | | PDB Id | | Target Id | APC36099 | | Molecular Characteristics | | Source | Bacillus stearothermophilus | | Alias Ids | TPS5534,RBSTP0775, 1422 | Molecular Weight | 24219.34 Da. | | Residues | 201 | Isoelectric Point | 5.82 | | Sequence | melrdridflcktilaiktagrlvlgidglsrsgkttlanqlsqtlreqgisvcvfhmddhiverakry htgneewfeyyylqwdvewlthqlfrqlkashqltlpfydhetdthskrtvylsdsdmimiegvflqrk ewrpffdfvvyldcpreirfarendqvkqniqkfinrywkaedyyleteepikradvvfdmts | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 1.90 | Rfree | 0.238 | | Matthews' coefficent | 2.22 | Rfactor | 0.203 | | Waters | 217 | Solvent Content | 44.64 |
| Ligand Information | | Ligands | ACT (ACETATE) x 1 | | Metals | CA (CALCIUM) x 1 | | |
