| Title | 1.6A crystal structure of a hypothetical protein yfbM from E. coli. To be Published | | Site | MCSG | | PDB Id | | Target Id | APC5028 | | Molecular Characteristics | | Source | Escherichia coli | | Alias Ids | TPS4641,NP_416775, 562 | Molecular Weight | 19017.62 Da. | | Residues | 167 | Isoelectric Point | 4.83 | | Sequence | mgmigyfaeidsekinqllestekplmdnihdtlsglrrldidkrwdflhfgltgtsafdpakndplsr avlgehsledgidgflgltwnqelaatidrlesldrnelrkqfsikrlnemeiypgvtfseelegqlfa simldmeklisayrrmlrqgnhaltvivg | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 1.60 | Rfree | 0.259 | | Matthews' coefficent | 2.17 | Rfactor | 0.212 | | Waters | 259 | Solvent Content | 43.32 |
| Ligand Information | | Ligands | | | Metals | | | |
