.
The Open Protein Structure Annotation Network
PDB Keyword
.

1ryl

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary
    Title 1.6A crystal structure of a hypothetical protein yfbM from E. coli. To be Published
    Site MCSG
    PDB Id 1ryl Target Id APC5028
    Molecular Characteristics
    Source Escherichia coli
    Alias Ids TPS4641,NP_416775, 562 Molecular Weight 19017.62 Da.
    Residues 167 Isoelectric Point 4.83
    Sequence mgmigyfaeidsekinqllestekplmdnihdtlsglrrldidkrwdflhfgltgtsafdpakndplsr avlgehsledgidgflgltwnqelaatidrlesldrnelrkqfsikrlnemeiypgvtfseelegqlfa simldmeklisayrrmlrqgnhaltvivg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.259
    Matthews' coefficent 2.17 Rfactor 0.212
    Waters 259 Solvent Content 43.32

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch