| Title | Crystal structure of conserved hypothetical protein TA0108 from Thermoplasma acidophilum. To be Published | | Site | MCSG | | PDB Id | | Target Id | APC5027 | | Molecular Characteristics | | Source | Thermoplasma acidophilum | | Alias Ids | TPS4640,CAC11256.1, 2303 | Molecular Weight | 13169.77 Da. | | Residues | 117 | Isoelectric Point | 6.59 | | Sequence | mvkkmviavrkdldmgkgkiaaqvahaavtcairsmkinrdvfnewydegqrkivvkvndldeimeikr madsmgivneivqdrgytqvepgtitciglgpdeeekldkitgkykll | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 1 | | Resolution (Å) | 1.95 | Rfree | 0.23894 | | Matthews' coefficent | 2.14 | Rfactor | 0.21241 | | Waters | 65 | Solvent Content | 42.41 |
| Ligand Information | | Ligands | SO4 (SULFATE) x 1;GOL (GLYCEROL) x 1 | | Metals | | | |
