.
The Open Protein Structure Annotation Network
PDB Keyword
.

1rlk

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of conserved hypothetical protein TA0108 from Thermoplasma acidophilum. To be Published
    Site MCSG
    PDB Id 1rlk Target Id APC5027
    Molecular Characteristics
    Source Thermoplasma acidophilum
    Alias Ids TPS4640,CAC11256.1, 2303 Molecular Weight 13169.77 Da.
    Residues 117 Isoelectric Point 6.59
    Sequence mvkkmviavrkdldmgkgkiaaqvahaavtcairsmkinrdvfnewydegqrkivvkvndldeimeikr madsmgivneivqdrgytqvepgtitciglgpdeeekldkitgkykll
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.95 Rfree 0.23894
    Matthews' coefficent 2.14 Rfactor 0.21241
    Waters 65 Solvent Content 42.41

    Ligand Information
    Ligands SO4 (SULFATE) x 1;GOL (GLYCEROL) x 1
    Metals

    Jmol

     
    Google Scholar output for 1rlk
    1. Determining protein topology from skeletons of secondary structures
    Y Wu, M Chen, M Lu, Q Wang, J Ma - Journal of molecular biology, 2005 - Elsevier
     
    2. Solution structure of Archaeglobus fulgidis peptidyl_tRNA hydrolase (Pth2) provides evidence for an extensive conserved family of Pth2 enzymes in archea, bacteria,
    R Powers, N Mirkovic, S Goldsmith_Fischman - Protein , 2005 - Wiley Online Library
     
    3. Crystal structure at 1.8 resolution and identification of active site residues of Sulfolobus solfataricus peptidyl-tRNA hydrolase
    M Fromant, E Schmitt, Y Mechulam, C Lazennec - Biochemistry, 2005 - ACS Publications
     
    4. Structure of peptidyl-tRNA hydrolase 2 from Pyrococcus horikoshii OT3: insight into the functional role of its dimeric state
    K Shimizu, C Kuroishi, M Sugahara - Section D: Biological , 2008 - scripts.iucr.org
     
    5. Limits of Constitutional Text and Structure Revisited, The
    A Stone - UNSWLJ, 2005 - HeinOnline
     
    6. Cartographie structurale et fonctionnelle de la liaison entre la peptidyl-ARNt hydrolase et son substrat
    G Laurent - 2010 - hal-polytechnique.archives-ouvertes
     
    7. Modeling Protein Structures Based on Density Maps at Intermediate Resolutions
    J Ma - Computational Methods for Protein Structure Prediction , 2007 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch