.
The Open Protein Structure Annotation Network
PDB Keyword
.

1rlj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title 1.5A crystal structure of a thioredoxin-like protein NrdI from Bacillus subtilis. To be Published
    Site MCSG
    PDB Id 1rlj Target Id APC1355
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS4535,P50618, 1423 Molecular Weight 14601.93 Da.
    Residues 130 Isoelectric Point 7.97
    Sequence mvqiifdsktgnvqrfvnktgfqqirkvdemdhvdtpfvlvtyttnfgqvpastqsflekyahlllgva asgnkvwgdnfaksadtisrqyqvpilhkfelsgtskdvelftqevervvtkssakmdpvk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.217
    Matthews' coefficent 4.01 Rfactor 0.192
    Waters 132 Solvent Content 69.32

    Ligand Information
    Ligands FMN (FLAVIN) x 1
    Metals IOD (IODIDE) x 2

    Jmol

     
    Google Scholar output for 1rlj
    1. Prediction of protein structure from ideal forms
    WR Taylor, GJ Bartlett, V Chelliah - Proteins: Structure, , 2008 - Wiley Online Library
     
    2. Comparative protein modeling
    EX Esposito, D Tobi, JD Madura - Reviews in computational , 2006 - Wiley Online Library
     
    3. Functional site prediction selects correct protein models
    V Chelliah, WR Taylor - BMC bioinformatics, 2008 - biomedcentral.com
     
    4. High_resolution crystal structures of the flavoprotein NrdI in oxidized and reduced statesan unusual flavodoxin
    R Johansson, E Torrents, D Lundin, J Sprenger - FEBS , 2010 - Wiley Online Library
     
    5. Search for identical octapeptides in unrelated proteins: Structural plasticity revisited
    KM Saravanan, S Selvaraj - Peptide Science, 2012 - Wiley Online Library
     
    6. Dimensionality reduction in computational demarcation of protein tertiary structures
    RR Joshi, PR Panigrahi, RN Patil - Journal of Molecular Modeling, 2011 - Springer
     
    7. Structure-Function Studies of the Large Subunit of Ribonucleotide Reductase from Homo sapiens and Saccharomyces cerevisiae
    JW Fairman - Doctoral Dissertations, 2009 - trace.tennessee.edu
     
    8. Modelling Protein Structure Using Discrete Backbone Torsion Angles
    P Smith - 2010 - unsworks.unsw.edu.au
     
    9. Comparative Protein Modeling
    JD Maduraz - Reviews in Computational Chemistry, 2006 - books.google.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch