.
The Open Protein Structure Annotation Network
PDB Keyword
.

1rkt

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of YfiR, an unusual TetR/CamR-type putative transcriptional regulator from Bacillus subtilis. Proteins 65 255-257 2006
    Site MCSG
    PDB Id 1rkt Target Id APC1141
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS4502,O31560, 1423 Molecular Weight 23682.62 Da.
    Residues 205 Isoelectric Point 5.21
    Sequence mspkvtkehkdkrqaeileaaktvfkrkgfelttmkdvveesgfsrggvylyfssteemfrriietgld eglrkldksaehqsvwasissyldelteglrdvadtlapvqfeylvtawrneerrqylekrydlfverf srllqkgidqgefqpvqplatiakfflnmndgiiqnalyfdeekadvsglaesaklylktvlqadek
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.95 Rfree 0.25417
    Matthews' coefficent 2.51 Rfactor 0.20808
    Waters 123 Solvent Content 50.91

    Ligand Information
    Ligands UNX-UNX-UNX (UNKNOWN) x 1;UNX (UNKNOWN) x 30;UNX-UNX (UNKNOWN) x 3
    Metals

    Jmol

     
    Google Scholar output for 1rkt
    1. A comprehensive analysis of structural and sequence conservation in the TetR family transcriptional regulators
    Z Yu, SE Reichheld, A Savchenko, J Parkinson - Journal of molecular , 2010 - Elsevier
     
    2. Crystal structure of a putative HTH_type transcriptional regulator yxaF from Bacillus subtilis
    J Seetharaman, D Kumaran - Proteins: Structure, , 2006 - Wiley Online Library
     
    3. New insights into the structure, function and evolution of TETR family transcriptional regulators
    Z Yu - 2010 - 142.150.190.46
     
    4. Approximate Search on Protein Structures for Identification of Horizontal Gene Transfer in Bacteria
    S Billa, MA Griep, PZ Revesz - Ninth Symposium of Abstraction, , 2011 - aaai.org
     
    5. Protein StructureBased Method for Identification of Horizontal Gene Transfer in Bacteria
    S Billa - 2011 - digitalcommons.unl.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch