| Title | Structure of a Carboxylesterase from Bacillus stearothermophilus. TO BE PUBLISHED | | Site | MCSG | | PDB Id | | Target Id | APC36123 | | Molecular Characteristics | | Source | Bacillus stearothermophilus | | Alias Ids | TPS5537,RBSTP1697, 1422 | Molecular Weight | 28223.90 Da. | | Residues | 246 | Isoelectric Point | 5.17 | | Sequence | mkivppkpfffeageravlllhgftgnsadvrmlgrfleskgytchapiykghgvppeelvhtgpddww qdvmngyqflknkgyekiavaglslggvfslklgytvpiegivtmcapmyikseetmyegvleyareyk kregkseeqieqemerfkqtpmktlkalqeliadvrahldlvyaptfvvqarhdeminpdsaniiynei espvkqikwyeqsghvitldqekdqlhediyaflesldw | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 2.00 | Rfree | 0.245 | | Matthews' coefficent | 3.14 | Rfactor | 0.205 | | Waters | 658 | Solvent Content | 60.78 |
| Ligand Information | | Ligands | EPE (4-(2-HYDROXYETHYL)-1-PIPERAZINE) x 2 | | Metals | | | |
