.
The Open Protein Structure Annotation Network
PDB Keyword
.

1qwr

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure analysis of the mannose 6-phosphate isomerase from Bacillus subtilis. To be Published
    Site MCSG
    PDB Id 1qwr Target Id APC1763
    Molecular Characteristics
    Source Bacillus subtilis
    Alias Ids TPS4556,P39841, 1423 Molecular Weight 35426.15 Da.
    Residues 316 Isoelectric Point 5.15
    Sequence mtqspifltpvfkekiwggtalrdrfgysipsestgecwaisahpkgpstvangpykgktlielweehr evfggvegdrfplltklldvkedtsikvhpddyyageneegelgktecwyiidckenaeiiyghtarsk telvtminsgdwegllrrikikpgdfyyvpsgtlhalckgalvletqqnsdatyrvydydrldsngspr elhfakavnaatvphvdgyidestesrkgitiktfvqgeyfsvykwdingeaemaqdesflicsviegs gllkyedktcplkkgdhfilpaqmpdftikgtctlivshi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.232
    Matthews' coefficent 2.10 Rfactor 0.196
    Waters 558 Solvent Content 41.38

    Ligand Information
    Ligands SO4 (SULFATE) x 3;ACT (ACETATE) x 1;FMT (FORMIC) x 1
    Metals ZN (ZINC) x 2

    Jmol

     
    Google Scholar output for 1qwr
    1. The Structures of Inhibitor Complexes of Pyrococcus furiosus Phosphoglucose Isomerase Provide Insights into Substrate Binding and Catalysis
    JM Berrisford, J Akerboom, S Brouns - Journal of molecular , 2004 - Elsevier
     
    2. Prediction of 3D metal binding sites from translated gene sequences based on remote_homology templates
    R Levy, M Edelman, V Sobolev - Proteins: Structure, Function, , 2009 - Wiley Online Library
     
    3. Predicting molecular interactions in silico: I. an updated guide to pharmacophore identification and its applications to drug design
    O Dror, A Shulman-Peleg, R Nussinov - Frontiers in Medicinal , 2006 - ingentaconnect.com
     
    4. Computational study of human phosphomannose isomerase: insights from homology modeling and molecular dynamics simulation of enzyme bound substrate
    J Xiao, Z Guo, Y Guo, F Chu, P Sun - Journal of Molecular Graphics and , 2006 - Elsevier
     
    5. Analysis of chameleon sequences by energy decomposition on a pairwise per-residue basis
    S Yoon, H Jung - The protein journal, 2006 - Springer
     
    6. The reaction mechanism of type I phosphomannose isomerases: New information from inhibition and polarizable molecular mechanics studies
    C Roux, J Foret, B de Courcy, N Gresh - Proteins: Structure, , 2011 - Wiley Online Library
     
    7. Characterization of a Mannose-6-Phosphate Isomerase from Thermus thermophilus and Increased l-Ribose Production by Its R142N Mutant
    SJ Yeom, ES Seo, BN Kim, YS Kim - Applied and , 2011 - Am Soc Microbiol
     
    8. Structures of mannose-6-phosphate isomerase from Salmonella typhimurium bound to metal atoms and substrate: implications for catalytic mechanism
    SR Sagurthi, G Gowda, HS Savithri - Section D: Biological , 2009 - scripts.iucr.org
     
    9. Cloning, expression, purification, crystallization and preliminary X-ray crystallographic analysis of the mannose 6-phosphate isomerase from Salmonella typhimurium
    G Gowda, SR Sagurthi, HS Savithri - Section F: Structural , 2008 - scripts.iucr.org
     
    10. The crystal structure of 5_keto_4_deoxyuronate isomerase from Escherichia coli
    RL Crowther, MM Georgiadis - Proteins: Structure, Function, , 2005 - Wiley Online Library
     
    11. Bacterial Type II PMIs: Exploitable Bifunctional Enzymes for Biotechnological Applications and the Rational Design of Antimicrobials
    SA Sousa, CG Ramos, J Feliciano, JH Leito - 2010 - intechopen.com
     
    12. Molecular characterization of a novel thermostable mannose-6-phosphate isomerase from Thermus thermophilus
    SJ Yeom, YS Kim, YR Lim, KW Jeong, JY Lee, Y Kim - Biochimie, 2011 - Elsevier
     
    13. Production of l-ribose from l-ribulose by a triple-site variant of mannose-6-phosphate isomerase from Geobacillus thermodenitrificans
    YR Lim, SJ Yeom, DK Oh - Applied and environmental , 2012 - Am Soc Microbiol
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch