| Title | Lipid binding protein APC36103 from Bacillus Stearothermophilus. To be Published | | Site | MCSG | | PDB Id | | Target Id | APC36103 | | Molecular Characteristics | | Source | Bacillus stearothermophilus | | Alias Ids | TPS5535,RBSTP0788, 1422 | Molecular Weight | 32357.55 Da. | | Residues | 289 | Isoelectric Point | 6.02 | | Sequence | nampieiitdsgadlpqsyirehriaflplvvhwngqdykdgitiepkqvydamrqghtvktaqpspla mkelflpyakenrpclyiafssklsgtyqtamavrselldeypefrltiidskcaslgqglavmkavel akqntpynllcetiesycrhmehiftvdnldylarggrisktaaafggllnikpllhvedgaliplekw rgrkkvlkrmvelmgergddlqkqtigishaddeetalelkqmieethgctrfflsdigsaigahagpg tialfflnkyiei | | | BLAST FFAS | | Structure Determination | | Method | XRAY | Chains | 2 | | Resolution (Å) | 2.00 | Rfree | 0.252 | | Matthews' coefficent | 2.54 | Rfactor | 0.197 | | Waters | 347 | Solvent Content | 51.59 |
| Ligand Information | | Ligands | PLM (PALMITIC) x 2 | | Metals | | | |
