.
The Open Protein Structure Annotation Network
PDB Keyword
.

1pvt

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of sugar-phosphate aldolase from Thermotoga maritima. To be Published
    Site MCSG
    PDB Id 1pvt Target Id APC4569
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS4613,AAD36149, 2336 Molecular Weight 26751.58 Da.
    Residues 236 Isoelectric Point 5.54
    Sequence mretireiqkvaywlaikglseanagnisvrlderpegyevksvneygfdydgpemyllitatgsrmre vyeddskicllhvlpgkhyeilhgngkptsefpthlmihakfkemnpekkaivhthplnlltlmnleef qellpkmmkihpevliffpqgisvvefekpgsvelglktveksegkdavlwdkhgvvafgkdvaeaydr veilekaaeillrvlslgrnptgvpegwl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.50 Rfree 0.296
    Matthews' coefficent 2.90 Rfactor 0.257
    Waters 23 Solvent Content 57.63

    Pathway

    Reactions found in Metabolic Reconstruction for TM1072

    Name: Rhamnulose-1-phosphate aldolase
    Metabolic Subsystem: Rhamnose Metabolism
    Reaction: : rml1p <==> dhap + lald-L
    Classification: EC:4.1.2.19
     

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch